SCOPe 2.08: Domain d1ihbb_: 1ihb B:

Lineage for d1ihbb_ (1ihb B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein p18ink4C(ink6) [48412] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48413] (6 PDB entries)

8. Domain d1ihbb_: 1ihb B: [19162]

Details for d1ihbb_

PDB Entry: 1ihb, 1.95 Å

PDB Description: crystal structure of p18-ink4c(ink6)

PDB Compounds: (B:) cyclin-dependent kinase 6 inhibitor

SCOPe Domain Sequences for d1ihbb_:

Sequence; same for both SEQRES and ATOM records:

>d1ihbb_ d.211.1.1 (B:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]}
nelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpdlk
drtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvveflvkht
asnvghrnhkgdtacdlarlygrnevvslmqangag

Timeline for d1ihbb_:

• d1ihbb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ihbb_ appears in SCOPe 2.07