Lineage for d1ihba_ (1ihb A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 422776Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 422777Superfamily d.211.1: Ankyrin repeat [48403] (1 family) (S)
    repeats organized in elongated structures
  5. 422778Family d.211.1.1: Ankyrin repeat [48404] (14 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 422827Protein p18ink4C(ink6) [48412] (1 species)
  7. 422828Species Human (Homo sapiens) [TaxId:9606] [48413] (6 PDB entries)
  8. 422829Domain d1ihba_: 1ihb A: [19161]

Details for d1ihba_

PDB Entry: 1ihb (more details), 1.95 Å

PDB Description: crystal structure of p18-ink4c(ink6)

SCOP Domain Sequences for d1ihba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens)}
wgnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpd
lkdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvveflvk
htasnvghrnhkgdtacdlarlygrnevvslmqang

SCOP Domain Coordinates for d1ihba_:

Click to download the PDB-style file with coordinates for d1ihba_.
(The format of our PDB-style files is described here.)

Timeline for d1ihba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ihbb_