SCOP 1.57: Domain d1blxb_: 1blx B:

Lineage for d1blxb_ (1blx B:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)

4. Superfamily a.118.2: Ankyrin repeat [48403] (1 family)

5. Family a.118.2.1: Ankyrin repeat [48404] (9 proteins)

6. Protein Cell cycle inhibitor p19ink4D [48409] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48411] (1 PDB entry)

8. Domain d1blxb_: 1blx B: [19160]
   Other proteins in same PDB: d1blxa_

Details for d1blxb_

PDB Entry: 1blx, 1.9 Å

PDB Description: p19ink4d/cdk6 complex

SCOP Domain Sequences for d1blxb_:

Sequence; same for both SEQRES and ATOM records:

>d1blxb_ a.118.2.1 (B:) Cell cycle inhibitor p19ink4D {Mouse (Mus musculus)}
vcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspavalellkqga
spnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireghssvvsf
lapesdlhhrdasgltplelarqrgaqnlmdilqghmmip

Timeline for d1blxb_:

• d1blxb_ first appeared (with stable ids) in SCOP 1.55
  
• d1blxb_ appears in SCOP 1.59
  
• d1blxb_ appears in the current release, SCOPe 2.08