Lineage for d1blxb_ (1blx B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50498Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 50602Superfamily a.118.2: Ankyrin repeat [48403] (1 family) (S)
  5. 50603Family a.118.2.1: Ankyrin repeat [48404] (9 proteins)
  6. 50615Protein Cell cycle inhibitor p19ink4D [48409] (2 species)
  7. 50620Species Mouse (Mus musculus) [TaxId:10090] [48411] (1 PDB entry)
  8. 50621Domain d1blxb_: 1blx B: [19160]
    Other proteins in same PDB: d1blxa_

Details for d1blxb_

PDB Entry: 1blx (more details), 1.9 Å

PDB Description: p19ink4d/cdk6 complex

SCOP Domain Sequences for d1blxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blxb_ a.118.2.1 (B:) Cell cycle inhibitor p19ink4D {Mouse (Mus musculus)}
vcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspavalellkqga
spnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireghssvvsf
lapesdlhhrdasgltplelarqrgaqnlmdilqghmmip

SCOP Domain Coordinates for d1blxb_:

Click to download the PDB-style file with coordinates for d1blxb_.
(The format of our PDB-style files is described here.)

Timeline for d1blxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1blxa_