SCOPe 2.08: Domain d1blxb_: 1blx B:

Lineage for d1blxb_ (1blx B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein Cell cycle inhibitor p19ink4D [48409] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48411] (1 PDB entry)

8. Domain d1blxb_: 1blx B: [19160]
   Other proteins in same PDB: d1blxa_
   complexed with ca
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1blxb_

PDB Entry: 1blx, 1.9 Å

PDB Description: p19ink4d/cdk6 complex

PDB Compounds: (B:) p19ink4d

SCOPe Domain Sequences for d1blxb_:

Sequence; same for both SEQRES and ATOM records:

>d1blxb_ d.211.1.1 (B:) Cell cycle inhibitor p19ink4D {Mouse (Mus musculus) [TaxId: 10090]}
vcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspavalellkqga
spnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireghssvvsf
lapesdlhhrdasgltplelarqrgaqnlmdilqghmmip

Timeline for d1blxb_:

• d1blxb_ first appeared (with stable ids) in SCOP 1.55
  
• d1blxb_ appears in SCOPe 2.07