Lineage for d1bi8d_ (1bi8 D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238947Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2238948Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2238949Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
  6. 2238982Protein Cell cycle inhibitor p19ink4D [48409] (2 species)
  7. 2238983Species Human (Homo sapiens) [TaxId:9606] [48410] (2 PDB entries)
  8. 2238986Domain d1bi8d_: 1bi8 D: [19159]
    Other proteins in same PDB: d1bi8a_, d1bi8c_

Details for d1bi8d_

PDB Entry: 1bi8 (more details), 2.8 Å

PDB Description: mechanism of g1 cyclin dependent kinase inhibition from the structures cdk6-p19ink4d inhibitor complex
PDB Compounds: (D:) cyclin-dependent kinase inhibitor

SCOPe Domain Sequences for d1bi8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bi8d_ d.211.1.1 (D:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]}
vragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqga
spnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsf
laaesdlhrrdargltplelalqrgaqdlvdilqg

SCOPe Domain Coordinates for d1bi8d_:

Click to download the PDB-style file with coordinates for d1bi8d_.
(The format of our PDB-style files is described here.)

Timeline for d1bi8d_: