Lineage for d1bi8d_ (1bi8 D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6122Superfamily a.118.2: Ankyrin repeat [48403] (1 family) (S)
  5. 6123Family a.118.2.1: Ankyrin repeat [48404] (9 proteins)
  6. 6135Protein Cell cycle inhibitor p19ink4D [48409] (2 species)
  7. 6136Species Human (Homo sapiens) [TaxId:9606] [48410] (2 PDB entries)
  8. 6139Domain d1bi8d_: 1bi8 D: [19159]
    Other proteins in same PDB: d1bi8a_, d1bi8c_

Details for d1bi8d_

PDB Entry: 1bi8 (more details), 2.8 Å

PDB Description: mechanism of g1 cyclin dependent kinase inhibition from the structures cdk6-p19ink4d inhibitor complex

SCOP Domain Sequences for d1bi8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bi8d_ a.118.2.1 (D:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens)}
vragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqga
spnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsf
laaesdlhrrdargltplelalqrgaqdlvdilqg

SCOP Domain Coordinates for d1bi8d_:

Click to download the PDB-style file with coordinates for d1bi8d_.
(The format of our PDB-style files is described here.)

Timeline for d1bi8d_: