SCOPe 2.03: Domain d1bi8b_: 1bi8 B:

Lineage for d1bi8b_ (1bi8 B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein Cell cycle inhibitor p19ink4D [48409] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48410] (2 PDB entries)

8. Domain d1bi8b_: 1bi8 B: [19158]
   Other proteins in same PDB: d1bi8a_, d1bi8c_

Details for d1bi8b_

PDB Entry: 1bi8, 2.8 Å

PDB Description: mechanism of g1 cyclin dependent kinase inhibition from the structures cdk6-p19ink4d inhibitor complex

PDB Compounds: (B:) cyclin-dependent kinase inhibitor

SCOPe Domain Sequences for d1bi8b_:

Sequence; same for both SEQRES and ATOM records:

>d1bi8b_ d.211.1.1 (B:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]}
vragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqga
spnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsf
laaesdlhrrdargltplelalqrgaqdlvdilqg

Timeline for d1bi8b_:

• d1bi8b_ first appeared (with stable ids) in SCOP 1.55
  
• d1bi8b_ appears in SCOPe 2.02
  
• d1bi8b_ appears in SCOPe 2.04
  
• d1bi8b_ appears in the current release, SCOPe 2.08