Lineage for d1ycsb1 (1ycs B:327-456)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50498Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 50602Superfamily a.118.2: Ankyrin repeat [48403] (1 family) (S)
  5. 50603Family a.118.2.1: Ankyrin repeat [48404] (9 proteins)
  6. 50604Protein 53BP2 [48405] (1 species)
  7. 50605Species Human (Homo sapiens) [TaxId:9606] [48406] (1 PDB entry)
  8. 50606Domain d1ycsb1: 1ycs B:327-456 [19155]
    Other proteins in same PDB: d1ycsa_, d1ycsb2

Details for d1ycsb1

PDB Entry: 1ycs (more details), 2.2 Å

PDB Description: p53-53bp2 complex

SCOP Domain Sequences for d1ycsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycsb1 a.118.2.1 (B:327-456) 53BP2 {Human (Homo sapiens)}
plallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflvqfgvnv
naadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeegytqcsq
flygvqekmg

SCOP Domain Coordinates for d1ycsb1:

Click to download the PDB-style file with coordinates for d1ycsb1.
(The format of our PDB-style files is described here.)

Timeline for d1ycsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ycsb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ycsa_