![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (26 families) ![]() |
![]() | Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein) automatically mapped to Pfam PF00613 this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain |
![]() | Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48402] (65 PDB entries) |
![]() | Domain d1he8a1: 1he8 A:525-725 [19154] Other proteins in same PDB: d1he8a2, d1he8a3, d1he8a4, d1he8b_ complexed with gnp, mg |
PDB Entry: 1he8 (more details), 3 Å
SCOPe Domain Sequences for d1he8a1:
Sequence, based on SEQRES records: (download)
>d1he8a1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]} hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia qsrhyqqrfavileaylrgcg
>d1he8a1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]} hpisaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsa larfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcg
Timeline for d1he8a1: