Lineage for d1e8za1 (1e8z A:525-725)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6047Superfamily a.118.1: ARM repeat [48371] (6 families) (S)
  5. 6110Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
  6. 6111Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 6112Species Human (Homo sapiens) [TaxId:9606] [48402] (3 PDB entries)
  8. 6114Domain d1e8za1: 1e8z A:525-725 [19153]
    Other proteins in same PDB: d1e8za2, d1e8za3, d1e8za4

Details for d1e8za1

PDB Entry: 1e8z (more details), 2.4 Å

PDB Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine
PDB Compounds: (A:)

SCOP Domain Sequences for d1e8za1:

Sequence, based on SEQRES records: (download)

>d1e8za1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens)}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d1e8za1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens)}
hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
ylrgcg

SCOP Domain Coordinates for d1e8za1:

Click to download the PDB-style file with coordinates for d1e8za1.
(The format of our PDB-style files is described here.)

Timeline for d1e8za1: