Lineage for d1e90a1 (1e90 A:525-725)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725640Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 2725641Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 2725720Species Pig (Sus scrofa) [TaxId:9823] [48401] (6 PDB entries)
  8. 2725726Domain d1e90a1: 1e90 A:525-725 [19150]
    Other proteins in same PDB: d1e90a2, d1e90a3, d1e90a4, d1e90a5
    complexed with myc

Details for d1e90a1

PDB Entry: 1e90 (more details), 2.7 Å

PDB Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine
PDB Compounds: (A:) phosphatidylinositol 3-kinase catalytic subunit

SCOPe Domain Sequences for d1e90a1:

Sequence, based on SEQRES records: (download)

>d1e90a1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa) [TaxId: 9823]}
hpialpkhrptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
dpkaypklfssvkwgqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d1e90a1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa) [TaxId: 9823]}
hpialpempnqlrkqleaiiatdplnpltaedkellwhfryeslkdpkaypklfssvkwg
qqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
ylrgcg

SCOPe Domain Coordinates for d1e90a1:

Click to download the PDB-style file with coordinates for d1e90a1.
(The format of our PDB-style files is described here.)

Timeline for d1e90a1: