SCOP 1.61: Domain d1e7va1: 1e7v A:525-725

Lineage for d1e7va1 (1e7v A:525-725)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (16 superfamilies)

4. Superfamily a.118.1: ARM repeat [48371] (10 families)

5. Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
   this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain

6. Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [48401] (5 PDB entries)

8. Domain d1e7va1: 1e7v A:525-725 [19149]
   Other proteins in same PDB: d1e7va2, d1e7va3, d1e7va4

Details for d1e7va1

PDB Entry: 1e7v, 2.4 Å

PDB Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine

SCOP Domain Sequences for d1e7va1:

Sequence, based on SEQRES records:

>d1e7va1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa)}
hpialpkhrptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
dpkaypklfssvkwgqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records):

>d1e7va1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa)}
hpialpkempnqlrkqleaiiatdplnpltaedkellwhfryeslkdpkaypklfssvkw
gqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlh
yllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavile
aylrgcg

Timeline for d1e7va1:

• d1e7va1 first appeared (with stable ids) in SCOP 1.55
  
• d1e7va1 appears in SCOP 1.59
  
• d1e7va1 appears in SCOP 1.63
  
• d1e7va1 appears in the current release, SCOPe 2.08