SCOP 1.61: Domain d1e8xa1: 1e8x A:525-725

Lineage for d1e8xa1 (1e8x A:525-725)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (16 superfamilies)

4. Superfamily a.118.1: ARM repeat [48371] (10 families)

5. Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
   this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain

6. Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [48401] (5 PDB entries)

8. Domain d1e8xa1: 1e8x A:525-725 [19148]
   Other proteins in same PDB: d1e8xa2, d1e8xa3, d1e8xa4

Details for d1e8xa1

PDB Entry: 1e8x, 2.2 Å

PDB Description: structural insights into phoshoinositide 3-kinase enzymatic mechanism and signalling

SCOP Domain Sequences for d1e8xa1:

Sequence, based on SEQRES records:

>d1e8xa1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa)}
hpialpkhrptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
dpkaypklfssvkwgqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records):

>d1e8xa1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa)}
hpialempnqlrkqleaiiatdplnpltaedkellwhfryeslkdpkaypklfssvkwgq
qeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyl
lqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileay
lrgcg

Timeline for d1e8xa1:

• d1e8xa1 first appeared (with stable ids) in SCOP 1.55
  
• d1e8xa1 appears in SCOP 1.59
  
• d1e8xa1 appears in SCOP 1.63
  
• d1e8xa1 appears in the current release, SCOPe 2.08