SCOPe 2.08: Domain d1bpob1: 1bpo B:331-493

Lineage for d1bpob1 (1bpo B:331-493)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.4: Clathrin heavy-chain linker domain [48393] (1 protein)
   this is a repeat family; one repeat unit is 1bpo B:444-471 found in domain

6. Protein Clathrin heavy-chain linker domain [48394] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48395] (5 PDB entries)

8. Domain d1bpob1: 1bpo B:331-493 [19144]
   Other proteins in same PDB: d1bpoa2, d1bpob2, d1bpoc2
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1bpob1

PDB Entry: 1bpo, 2.6 Å

PDB Description: clathrin heavy-chain terminal domain and linker

PDB Compounds: (B:) protein (clathrin)

SCOPe Domain Sequences for d1bpob1:

Sequence; same for both SEQRES and ATOM records:

>d1bpob1 a.118.1.4 (B:331-493) Clathrin heavy-chain linker domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eeniipyitnvlqnpdlalrmavrnnlagaeelfarkfnalfaqgnyseaakvaanapkg
ilrtpdtirrfqsvpaqpgqtspllqyfgilldqgqlnkyeslelcrpvlqqgrkqllek
wlkedklecseelgdlvksvdptlalsvylranvpnkviqcfa

Timeline for d1bpob1:

• d1bpob1 first appeared (with stable ids) in SCOP 1.55
  
• d1bpob1 appears in SCOPe 2.07