Lineage for d1bpoa1 (1bpo A:331-487)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725623Family a.118.1.4: Clathrin heavy-chain linker domain [48393] (1 protein)
    this is a repeat family; one repeat unit is 1bpo B:444-471 found in domain
  6. 2725624Protein Clathrin heavy-chain linker domain [48394] (1 species)
  7. 2725625Species Norway rat (Rattus norvegicus) [TaxId:10116] [48395] (5 PDB entries)
  8. 2725629Domain d1bpoa1: 1bpo A:331-487 [19143]
    Other proteins in same PDB: d1bpoa2, d1bpob2, d1bpoc2
    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1bpoa1

PDB Entry: 1bpo (more details), 2.6 Å

PDB Description: clathrin heavy-chain terminal domain and linker
PDB Compounds: (A:) protein (clathrin)

SCOPe Domain Sequences for d1bpoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpoa1 a.118.1.4 (A:331-487) Clathrin heavy-chain linker domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eeniipyitnvlqnpdlalrmavrnnlagaeelfarkfnalfaqgnyseaakvaanapkg
ilrtpdtirrfqsvpaqpgqtspllqyfgilldqgqlnkyeslelcrpvlqqgrkqllek
wlkedklecseelgdlvksvdptlalsvylranvpnk

SCOPe Domain Coordinates for d1bpoa1:

Click to download the PDB-style file with coordinates for d1bpoa1.
(The format of our PDB-style files is described here.)

Timeline for d1bpoa1: