Lineage for d1hu3a_ (1hu3 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745106Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1745477Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
  6. 1745507Protein Eukaryotic initiation factor eIF4G [48388] (1 species)
  7. 1745508Species Human (Homo sapiens) [TaxId:9606] [48389] (2 PDB entries)
  8. 1745513Domain d1hu3a_: 1hu3 A: [19137]
    middle domain

Details for d1hu3a_

PDB Entry: 1hu3 (more details), 2.37 Å

PDB Description: middle domain of human eif4gii
PDB Compounds: (A:) eif4gii

SCOPe Domain Sequences for d1hu3a_:

Sequence, based on SEQRES records: (download)

>d1hu3a_ a.118.1.14 (A:) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}
sdpeniktqelfrkvrsilnkltpqmfnqlmkqvsgltvdteerlkgvidlvfekaidep
sfsvayanmcrclvtlkvpmadkpgntvnfrklllnrcqkefekdkadddvfekkqkele
aasapeertrlhdeleeakdkarrrsignikfigelfklkmlteaimhdcvvkllknhde
esleclcrllttigkdldfekakprmdqyfnqmekivkerktssrirfmlqdvidlrlcn
wvs

Sequence, based on observed residues (ATOM records): (download)

>d1hu3a_ a.118.1.14 (A:) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}
sdpeniktqelfrkvrsilnkltpqmfnqlmkqvsgltvdteerlkgvidlvfekaidep
sfsvayanmcrclvtlkvpnfrklllnrcqkefekdkaakdkarrrsignikfigelfkl
kmlteaimhdcvvkllknhdeesleclcrllttigkdldfekakprmdqyfnqmekivke
rktssrirfmlqdvidlrlcnwvs

SCOPe Domain Coordinates for d1hu3a_:

Click to download the PDB-style file with coordinates for d1hu3a_.
(The format of our PDB-style files is described here.)

Timeline for d1hu3a_: