Lineage for d1hu3a_ (1hu3 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 646821Superfamily a.118.1: ARM repeat [48371] (22 families) (S)
  5. 646987Family a.118.1.14: MIF4G domain-like [100908] (5 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 647017Protein Eukaryotic initiation factor eIF4G [48388] (1 species)
  7. 647018Species Human (Homo sapiens) [TaxId:9606] [48389] (2 PDB entries)
  8. 647023Domain d1hu3a_: 1hu3 A: [19137]
    middle domain

Details for d1hu3a_

PDB Entry: 1hu3 (more details), 2.37 Å

PDB Description: middle domain of human eif4gii
PDB Compounds: (A:) eif4gii

SCOP Domain Sequences for d1hu3a_:

Sequence, based on SEQRES records: (download)

>d1hu3a_ a.118.1.14 (A:) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}
sdpeniktqelfrkvrsilnkltpqmfnqlmkqvsgltvdteerlkgvidlvfekaidep
sfsvayanmcrclvtlkvpmadkpgntvnfrklllnrcqkefekdkadddvfekkqkele
aasapeertrlhdeleeakdkarrrsignikfigelfklkmlteaimhdcvvkllknhde
esleclcrllttigkdldfekakprmdqyfnqmekivkerktssrirfmlqdvidlrlcn
wvs

Sequence, based on observed residues (ATOM records): (download)

>d1hu3a_ a.118.1.14 (A:) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}
sdpeniktqelfrkvrsilnkltpqmfnqlmkqvsgltvdteerlkgvidlvfekaidep
sfsvayanmcrclvtlkvpnfrklllnrcqkefekdkaakdkarrrsignikfigelfkl
kmlteaimhdcvvkllknhdeesleclcrllttigkdldfekakprmdqyfnqmekivke
rktssrirfmlqdvidlrlcnwvs

SCOP Domain Coordinates for d1hu3a_:

Click to download the PDB-style file with coordinates for d1hu3a_.
(The format of our PDB-style files is described here.)

Timeline for d1hu3a_: