Lineage for d1hu3a_ (1hu3 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6047Superfamily a.118.1: ARM repeat [48371] (6 families) (S)
  5. 6084Family a.118.1.2: HEAT repeat [48385] (2 proteins)
    this is a repeat family; one repeat unit is 1b3u A:295-335 found in domain
  6. 6089Protein Middle domain of eIF4G [48388] (1 species)
  7. 6090Species Human (Homo sapiens) [TaxId:9606] [48389] (1 PDB entry)
  8. 6091Domain d1hu3a_: 1hu3 A: [19137]

Details for d1hu3a_

PDB Entry: 1hu3 (more details), 2.37 Å

PDB Description: middle domain of human eif4gii

SCOP Domain Sequences for d1hu3a_:

Sequence, based on SEQRES records: (download)

>d1hu3a_ a.118.1.2 (A:) Middle domain of eIF4G {Human (Homo sapiens)}
sdpeniktqelfrkvrsilnkltpqmfnqlmkqvsgltvdteerlkgvidlvfekaidep
sfsvayanmcrclvtlkvpmadkpgntvnfrklllnrcqkefekdkadddvfekkqkele
aasapeertrlhdeleeakdkarrrsignikfigelfklkmlteaimhdcvvkllknhde
esleclcrllttigkdldfekakprmdqyfnqmekivkerktssrirfmlqdvidlrlcn
wvs

Sequence, based on observed residues (ATOM records): (download)

>d1hu3a_ a.118.1.2 (A:) Middle domain of eIF4G {Human (Homo sapiens)}
sdpeniktqelfrkvrsilnkltpqmfnqlmkqvsgltvdteerlkgvidlvfekaidep
sfsvayanmcrclvtlkvpnfrklllnrcqkefekdkaakdkarrrsignikfigelfkl
kmlteaimhdcvvkllknhdeesleclcrllttigkdldfekakprmdqyfnqmekivke
rktssrirfmlqdvidlrlcnwvs

SCOP Domain Coordinates for d1hu3a_:

Click to download the PDB-style file with coordinates for d1hu3a_.
(The format of our PDB-style files is described here.)

Timeline for d1hu3a_: