![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.14: MIF4G domain-like [100908] (6 proteins) duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain |
![]() | Protein Eukaryotic initiation factor eIF4G [48388] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48389] (2 PDB entries) |
![]() | Domain d1hu3a1: 1hu3 A:745-986 [19137] Other proteins in same PDB: d1hu3a2 middle domain applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1hu3 (more details), 2.37 Å
SCOPe Domain Sequences for d1hu3a1:
Sequence, based on SEQRES records: (download)
>d1hu3a1 a.118.1.14 (A:745-986) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]} dpeniktqelfrkvrsilnkltpqmfnqlmkqvsgltvdteerlkgvidlvfekaideps fsvayanmcrclvtlkvpmadkpgntvnfrklllnrcqkefekdkadddvfekkqkelea asapeertrlhdeleeakdkarrrsignikfigelfklkmlteaimhdcvvkllknhdee sleclcrllttigkdldfekakprmdqyfnqmekivkerktssrirfmlqdvidlrlcnw vs
>d1hu3a1 a.118.1.14 (A:745-986) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]} dpeniktqelfrkvrsilnkltpqmfnqlmkqvsgltvdteerlkgvidlvfekaideps fsvayanmcrclvtlkvpnfrklllnrcqkefekdkaakdkarrrsignikfigelfklk mlteaimhdcvvkllknhdeesleclcrllttigkdldfekakprmdqyfnqmekivker ktssrirfmlqdvidlrlcnwvs
Timeline for d1hu3a1: