SCOPe 2.08: Domain d1hu3a1: 1hu3 A:745-986

Lineage for d1hu3a1 (1hu3 A:745-986)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
   duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
   this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain

6. Protein Eukaryotic initiation factor eIF4G [48388] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48389] (2 PDB entries)

8. Domain d1hu3a1: 1hu3 A:745-986 [19137]
   Other proteins in same PDB: d1hu3a2
   middle domain
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1hu3a1

PDB Entry: 1hu3, 2.37 Å

PDB Description: middle domain of human eif4gii

PDB Compounds: (A:) eif4gii

SCOPe Domain Sequences for d1hu3a1:

Sequence, based on SEQRES records:

>d1hu3a1 a.118.1.14 (A:745-986) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}
dpeniktqelfrkvrsilnkltpqmfnqlmkqvsgltvdteerlkgvidlvfekaideps
fsvayanmcrclvtlkvpmadkpgntvnfrklllnrcqkefekdkadddvfekkqkelea
asapeertrlhdeleeakdkarrrsignikfigelfklkmlteaimhdcvvkllknhdee
sleclcrllttigkdldfekakprmdqyfnqmekivkerktssrirfmlqdvidlrlcnw
vs

Sequence, based on observed residues (ATOM records):

>d1hu3a1 a.118.1.14 (A:745-986) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}
dpeniktqelfrkvrsilnkltpqmfnqlmkqvsgltvdteerlkgvidlvfekaideps
fsvayanmcrclvtlkvpnfrklllnrcqkefekdkaakdkarrrsignikfigelfklk
mlteaimhdcvvkllknhdeesleclcrllttigkdldfekakprmdqyfnqmekivker
ktssrirfmlqdvidlrlcnwvs

Timeline for d1hu3a1:

• d1hu3a1 first appeared (with stable ids) in SCOP 1.55, called d1hu3a_
  
• d1hu3a1 appears in SCOPe 2.07