Lineage for d1b3ub_ (1b3u B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359729Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 359730Superfamily a.118.1: ARM repeat [48371] (14 families) (S)
  5. 359795Family a.118.1.2: HEAT repeat [48385] (1 protein)
    this is a repeat family; one repeat unit is 1b3u A:295-335 found in domain
  6. 359796Protein Constant regulatory domain of protein phosphatase 2a, pr65alpha [48386] (1 species)
  7. 359797Species Human (Homo sapiens) [TaxId:9606] [48387] (1 PDB entry)
  8. 359799Domain d1b3ub_: 1b3u B: [19136]

Details for d1b3ub_

PDB Entry: 1b3u (more details), 2.3 Å

PDB Description: crystal structure of constant regulatory domain of human pp2a, pr65alpha

SCOP Domain Sequences for d1b3ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3ub_ a.118.1.2 (B:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens)}
aaadgddslypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiyd
edevllalaeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehsp
sdleahfvplvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmv
rraaasklgefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedle
alvmptlrqaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraa
ashkvkefcenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdnt
iehllplflaqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrl
aiieympllagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahat
iipkvlamsgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnva
kslqkigpildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla

SCOP Domain Coordinates for d1b3ub_:

Click to download the PDB-style file with coordinates for d1b3ub_.
(The format of our PDB-style files is described here.)

Timeline for d1b3ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b3ua_