Lineage for d1b3ub_ (1b3u B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006480Family a.118.1.2: HEAT repeat [48385] (2 protein domains)
    Pfam PF02985
  6. 2006481Protein Constant regulatory domain of protein phosphatase 2a, pr65alpha [48386] (2 species)
  7. 2006482Species Human (Homo sapiens) [TaxId:9606] [48387] (12 PDB entries)
  8. 2006486Domain d1b3ub_: 1b3u B: [19136]

Details for d1b3ub_

PDB Entry: 1b3u (more details), 2.3 Å

PDB Description: crystal structure of constant regulatory domain of human pp2a, pr65alpha
PDB Compounds: (B:) protein (protein phosphatase pp2a)

SCOPe Domain Sequences for d1b3ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3ub_ a.118.1.2 (B:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}
aaadgddslypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiyd
edevllalaeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehsp
sdleahfvplvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmv
rraaasklgefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedle
alvmptlrqaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraa
ashkvkefcenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdnt
iehllplflaqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrl
aiieympllagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahat
iipkvlamsgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnva
kslqkigpildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla

SCOPe Domain Coordinates for d1b3ub_:

Click to download the PDB-style file with coordinates for d1b3ub_.
(The format of our PDB-style files is described here.)

Timeline for d1b3ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b3ua_