Lineage for d1bk6b_ (1bk6 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006432Protein Karyopherin alpha [48383] (2 species)
  7. 2006433Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48384] (6 PDB entries)
    Uniprot Q02821 12-514
  8. 2006443Domain d1bk6b_: 1bk6 B: [19134]

Details for d1bk6b_

PDB Entry: 1bk6 (more details), 2.8 Å

PDB Description: karyopherin alpha (yeast) + sv40 t antigen nls
PDB Compounds: (B:) karyopherin alpha

SCOPe Domain Sequences for d1bk6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bk6b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpemlq
leaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdyr
dyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliys
mdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgnivt
gndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlippl
vkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriievt
ldaleniikmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiety
fg

SCOPe Domain Coordinates for d1bk6b_:

Click to download the PDB-style file with coordinates for d1bk6b_.
(The format of our PDB-style files is described here.)

Timeline for d1bk6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bk6a_