Lineage for d1bk6b_ (1bk6 B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.1: ARM repeat [48371] (28 families) 
Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
Protein Karyopherin alpha [48383] (2 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48384] (6 PDB entries)
Uniprot Q02821 12-514
Domain d1bk6b_: 1bk6 B: [19134]
Details for d1bk6b_
PDB Entry: 1bk6 (more details), 2.8 Å
PDB Description: karyopherin alpha (yeast) + sv40 t antigen nls
PDB Compounds: (B:) karyopherin alphaSCOPe Domain Sequences for d1bk6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bk6b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpemlq
leaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdyr
dyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliys
mdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgnivt
gndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlippl
vkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriievt
ldaleniikmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiety
fg
SCOPe Domain Coordinates for d1bk6b_:
Click to download the PDB-style file with coordinates for d1bk6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bk6b_:
- d1bk6b_ first appeared (with stable ids) in SCOP 1.55
- d1bk6b_ appears in SCOPe 2.07
View in 3D
