Lineage for d1bk6a_ (1bk6 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542684Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 542685Superfamily a.118.1: ARM repeat [48371] (17 families) (S)
  5. 542686Family a.118.1.1: Armadillo repeat [48372] (6 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 542742Protein Karyopherin alpha [48383] (1 species)
  7. 542743Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48384] (6 PDB entries)
  8. 542752Domain d1bk6a_: 1bk6 A: [19133]

Details for d1bk6a_

PDB Entry: 1bk6 (more details), 2.8 Å

PDB Description: karyopherin alpha (yeast) + sv40 t antigen nls

SCOP Domain Sequences for d1bk6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bk6a_ a.118.1.1 (A:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae)}
lpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpemlq
leaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdyr
dyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliys
mdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgnivt
gndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlippl
vkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriievt
ldaleniikmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiety
fg

SCOP Domain Coordinates for d1bk6a_:

Click to download the PDB-style file with coordinates for d1bk6a_.
(The format of our PDB-style files is described here.)

Timeline for d1bk6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bk6b_