Lineage for d1bk5a_ (1bk5 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332676Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2332776Protein Karyopherin alpha [48383] (2 species)
  7. 2332777Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48384] (6 PDB entries)
    Uniprot Q02821 12-514
  8. 2332781Domain d1bk5a_: 1bk5 A: [19130]
    complexed with co

Details for d1bk5a_

PDB Entry: 1bk5 (more details), 2.2 Å

PDB Description: karyopherin alpha from saccharomyces cerevisiae
PDB Compounds: (A:) karyopherin alpha

SCOPe Domain Sequences for d1bk5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bk5a_ a.118.1.1 (A:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpemlq
leaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdyr
dyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliys
mdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgnivt
gndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlippl
vkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriievt
ldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiety
fg

SCOPe Domain Coordinates for d1bk5a_:

Click to download the PDB-style file with coordinates for d1bk5a_.
(The format of our PDB-style files is described here.)

Timeline for d1bk5a_: