Lineage for d1qbkb_ (1qbk B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006447Protein Karyopherin beta2 [48381] (1 species)
  7. 2006448Species Human (Homo sapiens) [TaxId:9606] [48382] (1 PDB entry)
  8. 2006449Domain d1qbkb_: 1qbk B: [19127]
    Other proteins in same PDB: d1qbkc_
    complexed with gnp, mg

Details for d1qbkb_

PDB Entry: 1qbk (more details), 3 Å

PDB Description: structure of the karyopherin beta2-ran gppnhp nuclear transport complex
PDB Compounds: (B:) karyopherin beta2

SCOPe Domain Sequences for d1qbkb_:

Sequence, based on SEQRES records: (download)

>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]}
yewkpdeqglqqilqllkesqspdttiqrtvqqkleqlnqypdfnnylifvltklksede
ptrslsglilknnvkahfqnfpngvtdfikseclnnigdsspliratvgilittiaskge
lqnwpdllpklcslldsedyntcegafgalqkicedsaeildsdvldrplnimipkflqf
fkhsspkirshavacvnqfiisrtqalmlhidsftenlfalagdeepevrknvcralvml
levrmdrllphmhniveymlqrtqdqdenvaleacefwltlaeqpickdvlvrhlpklip
vlvngmkysdidiillkgdveedetipdseqdirprfhrsrtvaqqhdedgieeeddddd
eiddddtisdwnlrkcsaaaldvlanvyrdellphilpllkellfhhewvvkesgilvlg
aiaegcmqgmipylpeliphliqclsdkkalvrsitcwtlsryahwvvsqppdtylkplm
tellkrildsnkrvqeaacsafatleeeactelvpylayildtlvfafskyqhknllily
daigtladsvghhlnkpeyiqmlmppliqkwnmlkdedkdlfplleclssvatalqsgfl
pycepvyqrcvnlvqktlaqamlnnaqpdqyeapdkdfmivaldllsglaeglggnieql
varsniltlmyqcmqdkmpevrqssfallgdltkacfqhvkpciadfmpilgtnlnpefi
svcnnatwaigeisiqmgiemqpyipmvlhqlveiinrpntpktllentaitigrlgyvc
pqevapmlqqfirpwctslrnirdneekdsafrgictmisvnpsgviqdfiffcdavasw
inpkddlrdmfckilhgfknqvgdenwrrfsdqfplplkerlaafygv

Sequence, based on observed residues (ATOM records): (download)

>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]}
yewkpdeqglqqilqllkesqspdttiqrtvqqkleqlnqypdfnnylifvltklksede
ptrslsglilknnvkahfqnfpngvtdfikseclnnigdsspliratvgilittiaskge
lqnwpdllpklcslldsedyntcegafgalqkicedsaeildsdrplnimipkflqffkh
sspkirshavacvnqfiisrtqalmlhidsftenlfalagdeepevrknvcralvmllev
rmdrllphmhniveymlqrtqdqdenvaleacefwltlaeqpickdvlvrhlpklipvlv
ngmkysdidiillkgdveedetipdseqdirprfhrsrtvaqqhdeddddddeiddddti
sdwnlrkcsaaaldvlanvyrdellphilpllkellfhhewvvkesgilvlgaiaegcmq
gmipylpeliphliqclsdkkalvrsitcwtlsryahwvvsqppdtylkplmtellkril
dsnkrvqeaacsafatleeeactelvpylayildtlvfafskyqhknllilydaigtlad
svghhlnkpeyiqmlmppliqkwnmlkdedkdlfplleclssvatalqsgflpycepvyq
rcvnlvqktlaqamlnnaqpdqyeapdkdfmivaldllsglaeglggnieqlvarsnilt
lmyqcmqdkmpevrqssfallgdltkacfqhvkpciadfmpilgtnlnpefisvcnnatw
aigeisiqmgiemqpyipmvlhqlveiinrpntpktllentaitigrlgyvcpqevapml
qqfirpwctslrnirdneekdsafrgictmisvnpsgviqdfiffcdavaswinpkddlr
dmfckilhgfknqvgdenwrrfsdqfplplkerlaafygv

SCOPe Domain Coordinates for d1qbkb_:

Click to download the PDB-style file with coordinates for d1qbkb_.
(The format of our PDB-style files is described here.)

Timeline for d1qbkb_: