Lineage for d1gcjb1 (1gcj B:1-449)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332676Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2332749Protein Importin beta [48378] (3 species)
  7. 2332771Species Mouse (Mus musculus) [TaxId:10090] [48380] (2 PDB entries)
  8. 2332773Domain d1gcjb1: 1gcj B:1-449 [19126]
    Other proteins in same PDB: d1gcja2, d1gcja3, d1gcjb2, d1gcjb3

Details for d1gcjb1

PDB Entry: 1gcj (more details), 2.6 Å

PDB Description: n-terminal fragment of importin-beta
PDB Compounds: (B:) importin beta

SCOPe Domain Sequences for d1gcjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcjb1 a.118.1.1 (B:1-449) Importin beta {Mouse (Mus musculus) [TaxId: 10090]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
ipvsqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllstcce
ddivphvlpfikehiknpdwryrdaavmafgsilegpepnqlkplviqamptlielmkdp
svvvrdttawtvgricellpeaaindvyl

SCOPe Domain Coordinates for d1gcjb1:

Click to download the PDB-style file with coordinates for d1gcjb1.
(The format of our PDB-style files is described here.)

Timeline for d1gcjb1: