Lineage for d1gcja_ (1gcj A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1500528Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1500529Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 1500587Protein Importin beta [48378] (3 species)
  7. 1500609Species Mouse (Mus musculus) [TaxId:10090] [48380] (2 PDB entries)
  8. 1500610Domain d1gcja_: 1gcj A: [19125]

Details for d1gcja_

PDB Entry: 1gcj (more details), 2.6 Å

PDB Description: n-terminal fragment of importin-beta
PDB Compounds: (A:) importin beta

SCOPe Domain Sequences for d1gcja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcja_ a.118.1.1 (A:) Importin beta {Mouse (Mus musculus) [TaxId: 10090]}
pdyasgmelitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvar
vaaglqiknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcva
giacaeipvsqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneil
taiiqgmrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvr
vaalqnlvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdla
ieaseaaeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclml
lstcceddivphvlpfikehiknpdwryrdaavmafgsilegpepnqlkplviqamptli
elmkdpsvvvrdttawtvgricellpeaaindvylvpnss

SCOPe Domain Coordinates for d1gcja_:

Click to download the PDB-style file with coordinates for d1gcja_.
(The format of our PDB-style files is described here.)

Timeline for d1gcja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gcjb_