Lineage for d1gcja1 (1gcj A:1-449)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006405Protein Importin beta [48378] (3 species)
  7. 2006427Species Mouse (Mus musculus) [TaxId:10090] [48380] (2 PDB entries)
  8. 2006428Domain d1gcja1: 1gcj A:1-449 [19125]
    Other proteins in same PDB: d1gcja2, d1gcja3, d1gcjb2, d1gcjb3

Details for d1gcja1

PDB Entry: 1gcj (more details), 2.6 Å

PDB Description: n-terminal fragment of importin-beta
PDB Compounds: (A:) importin beta

SCOPe Domain Sequences for d1gcja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcja1 a.118.1.1 (A:1-449) Importin beta {Mouse (Mus musculus) [TaxId: 10090]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
ipvsqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllstcce
ddivphvlpfikehiknpdwryrdaavmafgsilegpepnqlkplviqamptlielmkdp
svvvrdttawtvgricellpeaaindvyl

SCOPe Domain Coordinates for d1gcja1:

Click to download the PDB-style file with coordinates for d1gcja1.
(The format of our PDB-style files is described here.)

Timeline for d1gcja1: