Lineage for d1f59a_ (1f59 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6047Superfamily a.118.1: ARM repeat [48371] (6 families) (S)
  5. 6048Family a.118.1.1: Armadillo repeat [48372] (5 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 6061Protein Importin beta [48378] (2 species)
  7. 6062Species Human (Homo sapiens) [TaxId:9606] [48379] (4 PDB entries)
  8. 6067Domain d1f59a_: 1f59 A: [19123]
    Other proteins in same PDB: d1f59c_, d1f59d_

Details for d1f59a_

PDB Entry: 1f59 (more details), 2.8 Å

PDB Description: importin-beta-fxfg nucleoporin complex

SCOP Domain Sequences for d1f59a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f59a_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens)}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
svvvrdtaawtvgricellp

SCOP Domain Coordinates for d1f59a_:

Click to download the PDB-style file with coordinates for d1f59a_.
(The format of our PDB-style files is described here.)

Timeline for d1f59a_: