![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.1: Armadillo repeat [48372] (7 proteins) this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain |
![]() | Protein Importin beta [48378] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48379] (11 PDB entries) |
![]() | Domain d1f59a_: 1f59 A: [19123] Other proteins in same PDB: d1f59c_, d1f59d_ applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1f59 (more details), 2.8 Å
SCOPe Domain Sequences for d1f59a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f59a_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp svvvrdtaawtvgricellp
Timeline for d1f59a_: