Lineage for d1f59a_ (1f59 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332676Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
  6. 2332749Protein Importin beta [48378] (3 species)
  7. 2332752Species Human (Homo sapiens) [TaxId:9606] [48379] (11 PDB entries)
  8. 2332758Domain d1f59a_: 1f59 A: [19123]
    Other proteins in same PDB: d1f59c_, d1f59d_

Details for d1f59a_

PDB Entry: 1f59 (more details), 2.8 Å

PDB Description: importin-beta-fxfg nucleoporin complex
PDB Compounds: (A:) importin beta-1

SCOPe Domain Sequences for d1f59a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f59a_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
svvvrdtaawtvgricellp

SCOPe Domain Coordinates for d1f59a_:

Click to download the PDB-style file with coordinates for d1f59a_.
(The format of our PDB-style files is described here.)

Timeline for d1f59a_: