Lineage for d1ibrd_ (1ibr D:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100538Fold a.118: alpha-alpha superhelix [48370] (13 superfamilies)
  4. 100539Superfamily a.118.1: ARM repeat [48371] (9 families) (S)
  5. 100540Family a.118.1.1: Armadillo repeat [48372] (5 proteins)
  6. 100564Protein Importin beta [48378] (2 species)
  7. 100565Species Human (Homo sapiens) [TaxId:9606] [48379] (4 PDB entries)
  8. 100568Domain d1ibrd_: 1ibr D: [19121]
    Other proteins in same PDB: d1ibra_, d1ibrc_

Details for d1ibrd_

PDB Entry: 1ibr (more details), 2.3 Å

PDB Description: complex of ran with importin beta

SCOP Domain Sequences for d1ibrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibrd_ a.118.1.1 (D:) Importin beta {Human (Homo sapiens)}
elitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglqi
knsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacaei
pvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqgm
rkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqnl
vkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieaseaa
eqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcced
divphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdps
vvvrdtaawtvgricell

SCOP Domain Coordinates for d1ibrd_:

Click to download the PDB-style file with coordinates for d1ibrd_.
(The format of our PDB-style files is described here.)

Timeline for d1ibrd_: