Lineage for d1ibrd_ (1ibr D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725423Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 2725501Protein Importin beta [48378] (3 species)
  7. 2725504Species Human (Homo sapiens) [TaxId:9606] [48379] (11 PDB entries)
  8. 2725508Domain d1ibrd_: 1ibr D: [19121]
    Other proteins in same PDB: d1ibra_, d1ibrc_
    complexed with gnp, mg
    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1ibrd_

PDB Entry: 1ibr (more details), 2.3 Å

PDB Description: complex of ran with importin beta
PDB Compounds: (D:) importin beta-1 subunit

SCOPe Domain Sequences for d1ibrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibrd_ a.118.1.1 (D:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
elitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglqi
knsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacaei
pvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqgm
rkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqnl
vkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieaseaa
eqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcced
divphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdps
vvvrdtaawtvgricell

SCOPe Domain Coordinates for d1ibrd_:

Click to download the PDB-style file with coordinates for d1ibrd_.
(The format of our PDB-style files is described here.)

Timeline for d1ibrd_: