Lineage for d1ibrb_ (1ibr B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1278586Superfamily a.118.1: ARM repeat [48371] (24 families) (S)
  5. 1278587Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
  6. 1278640Protein Importin beta [48378] (3 species)
  7. 1278643Species Human (Homo sapiens) [TaxId:9606] [48379] (10 PDB entries)
  8. 1278646Domain d1ibrb_: 1ibr B: [19120]
    Other proteins in same PDB: d1ibra_, d1ibrc_
    complexed with gnp, mg

Details for d1ibrb_

PDB Entry: 1ibr (more details), 2.3 Å

PDB Description: complex of ran with importin beta
PDB Compounds: (B:) importin beta-1 subunit

SCOPe Domain Sequences for d1ibrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
elitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglqi
knsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacaei
pvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqgm
rkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqnl
vkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieaseaa
eqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcced
divphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdps
vvvrdtaawtvgricellpeaaindvylapllqclieg

SCOPe Domain Coordinates for d1ibrb_:

Click to download the PDB-style file with coordinates for d1ibrb_.
(The format of our PDB-style files is described here.)

Timeline for d1ibrb_: