SCOPe 2.08: Domain d1ibrb_: 1ibr B:

Lineage for d1ibrb_ (1ibr B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
   this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain

6. Protein Importin beta [48378] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48379] (11 PDB entries)

8. Domain d1ibrb_: 1ibr B: [19120]
   Other proteins in same PDB: d1ibra_, d1ibrc_
   complexed with gnp, mg
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1ibrb_

PDB Entry: 1ibr, 2.3 Å

PDB Description: complex of ran with importin beta

PDB Compounds: (B:) importin beta-1 subunit

SCOPe Domain Sequences for d1ibrb_:

Sequence; same for both SEQRES and ATOM records:

>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
elitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglqi
knsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacaei
pvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqgm
rkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqnl
vkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieaseaa
eqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcced
divphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdps
vvvrdtaawtvgricellpeaaindvylapllqclieg

Timeline for d1ibrb_:

• d1ibrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ibrb_ appears in SCOPe 2.07