Lineage for d1ibrb_ (1ibr B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332676Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2332749Protein Importin beta [48378] (3 species)
  7. 2332752Species Human (Homo sapiens) [TaxId:9606] [48379] (11 PDB entries)
  8. 2332755Domain d1ibrb_: 1ibr B: [19120]
    Other proteins in same PDB: d1ibra_, d1ibrc_
    complexed with gnp, mg

Details for d1ibrb_

PDB Entry: 1ibr (more details), 2.3 Å

PDB Description: complex of ran with importin beta
PDB Compounds: (B:) importin beta-1 subunit

SCOPe Domain Sequences for d1ibrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
elitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglqi
knsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacaei
pvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqgm
rkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqnl
vkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieaseaa
eqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcced
divphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdps
vvvrdtaawtvgricellpeaaindvylapllqclieg

SCOPe Domain Coordinates for d1ibrb_:

Click to download the PDB-style file with coordinates for d1ibrb_.
(The format of our PDB-style files is described here.)

Timeline for d1ibrb_: