Lineage for d1qgra_ (1qgr A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006405Protein Importin beta [48378] (3 species)
  7. 2006408Species Human (Homo sapiens) [TaxId:9606] [48379] (11 PDB entries)
  8. 2006409Domain d1qgra_: 1qgr A: [19119]

Details for d1qgra_

PDB Entry: 1qgr (more details), 2.3 Å

PDB Description: structure of importin beta bound to the ibb domain of importin alpha (ii crystal form, grown at low ph)
PDB Compounds: (A:) protein (importin beta subunit)

SCOPe Domain Sequences for d1qgra_:

Sequence, based on SEQRES records: (download)

>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
yaeyqvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdi
alaiggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdq
envhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvear
pmihelltegrrsktnkaktlarwatkelrklknqa

Sequence, based on observed residues (ATOM records): (download)

>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
lqisdvvmasllrmfqsggvqedalmavstlvevlggeflkymeafkpflgiglknyaey
qvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdialai
ggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdqenvh
pdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvearpmih
elltegrrsktnkaktlarwatkelrklknqa

SCOPe Domain Coordinates for d1qgra_:

Click to download the PDB-style file with coordinates for d1qgra_.
(The format of our PDB-style files is described here.)

Timeline for d1qgra_: