Lineage for d1ejli_ (1ejl I:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50498Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 50499Superfamily a.118.1: ARM repeat [48371] (9 families) (S)
  5. 50500Family a.118.1.1: Armadillo repeat [48372] (5 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 50512Protein Importin alpha [48376] (1 species)
  7. 50513Species Mouse (Mus musculus) [TaxId:10090] [48377] (3 PDB entries)
  8. 50515Domain d1ejli_: 1ejl I: [19117]

Details for d1ejli_

PDB Entry: 1ejl (more details), 2.8 Å

PDB Description: mouse importin alpha-sv40 large t antigen nls peptide complex

SCOP Domain Sequences for d1ejli_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejli_ a.118.1.1 (I:) Importin alpha {Mouse (Mus musculus)}
gtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgkt
dcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniag
dgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveq
ilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivt
palraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq
qvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsa
kdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnl
iekyfs

SCOP Domain Coordinates for d1ejli_:

Click to download the PDB-style file with coordinates for d1ejli_.
(The format of our PDB-style files is described here.)

Timeline for d1ejli_: