Lineage for d1iala_ (1ial A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006377Protein Importin alpha [48376] (1 species)
  7. 2006378Species Mouse (Mus musculus) [TaxId:10090] [48377] (30 PDB entries)
  8. 2006394Domain d1iala_: 1ial A: [19116]

Details for d1iala_

PDB Entry: 1ial (more details), 2.5 Å

PDB Description: importin alpha, mouse
PDB Compounds: (A:) importin alpha

SCOPe Domain Sequences for d1iala_:

Sequence, based on SEQRES records: (download)

>d1iala_ a.118.1.1 (A:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}
deqmlkrrnvssfpddatsplqenrnnqgtvnwsvedivkginsnnlesqlqatqaarkl
lsrekqppidniiraglipkfvsflgktdcspiqfesawaltniasgtseqtkavvdgga
ipafisllasphahiseqavwalgniagdgsafrdlvikhgaidpllallavpdlstlac
gylrnltwtlsnlcrnknpappldaveqilptlvrllhhndpevladscwaisyltdgpn
eriemvvkkgvvpqlvkllgatelpivtpalraignivtgtdeqtqkvidagalavfpsl
ltnpktniqkeatwtmsnitagrqdqiqqvvnhglvpflvgvlskadfktqkeaawaitn
ytsggtveqivylvhcgiieplmnllsakdtkiiqvildaisnifqaaeklgeteklsim
ieecggldkiealqrhenesvykaslnliekyf

Sequence, based on observed residues (ATOM records): (download)

>d1iala_ a.118.1.1 (A:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}
deqmlkrrnvsnqgtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniira
glipkfvsflgktdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahi
seqavwalgniagdgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcr
nknpappldaveqilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpql
vkllgatelpivtpalraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwt
msnitagrqdqiqqvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvh
cgiieplmnllsakdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqr
henesvykaslnliekyf

SCOPe Domain Coordinates for d1iala_:

Click to download the PDB-style file with coordinates for d1iala_.
(The format of our PDB-style files is described here.)

Timeline for d1iala_: