Lineage for d1g3ja_ (1g3j A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006339Protein beta-Catenin [48373] (2 species)
  7. 2006340Species Human (Homo sapiens) [TaxId:9606] [48375] (8 PDB entries)
    Uniprot P35222 145-664
  8. 2006343Domain d1g3ja_: 1g3j A: [19114]
    Other proteins in same PDB: d1g3jb_, d1g3jd_
    complex with xtcf3-cbd

Details for d1g3ja_

PDB Entry: 1g3j (more details), 2.1 Å

PDB Description: crystal structure of the xtcf3-cbd/beta-catenin armadillo repeat complex
PDB Compounds: (A:) beta-catenin armadillo repeat region

SCOPe Domain Sequences for d1g3ja_:

Sequence, based on SEQRES records: (download)

>d1g3ja_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
havvnlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspq
mvsaivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlf
yaittlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskl
iilasggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdp
sqrlvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyk
nkmmvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpv
vvkllhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsm
ggtqqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqrv
aagvlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmse

Sequence, based on observed residues (ATOM records): (download)

>d1g3ja_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
havvnlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspq
mvsaivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlf
yaittlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskl
iilasggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdp
sqrlvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyk
nkmmvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpv
vvkllhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrfve
gvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcela
qdkeaaeaieaegatapltellhsrnegvatyaaavlfrmse

SCOPe Domain Coordinates for d1g3ja_:

Click to download the PDB-style file with coordinates for d1g3ja_.
(The format of our PDB-style files is described here.)

Timeline for d1g3ja_: