Lineage for d1bkds_ (1bkd S:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50492Fold a.117: Ras GEF [48365] (1 superfamily)
  4. 50493Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 50494Family a.117.1.1: Ras GEF [48367] (1 protein)
  6. 50495Protein Son of sevenless-1 (sos-1) [48368] (1 species)
  7. 50496Species Human (Homo sapiens) [TaxId:9606] [48369] (1 PDB entry)
  8. 50497Domain d1bkds_: 1bkd S: [19111]
    Other proteins in same PDB: d1bkdr_

Details for d1bkds_

PDB Entry: 1bkd (more details), 2.8 Å

PDB Description: complex of human h-ras with human sos-1
PDB Compounds: (S:)

SCOP Domain Sequences for d1bkds_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkds_ a.117.1.1 (S:) Son of sevenless-1 (sos-1) {Human (Homo sapiens)}
rlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtflttyrs
fckpqellsliierfeipeprfrkeyiqpvqlrvlnvcrhwvehhfydferdayllqrme
efigtvrgkamkkwvesitkiiqrkkitfqsspptvewhisrpghietfdlltlhpieia
rqltllesdlyravqpselvgsvwtkedkeinspnllkmirhttnltlwfekcivetenl
eervavvsriieilqvfqelnnfngvlevvsamnsspvyrldhtfeqipsrqkkileeah
elsedhykkylaklrsinppcvpffgiyltnilkteegnpevlkrhgkelinfskrrkva
eitgeiqqyqnqpyclrvesdikrffenlnpmgnsmekeftdylfnksleieprnpkplp
rfpkkysyplkspgvrpsn

SCOP Domain Coordinates for d1bkds_:

Click to download the PDB-style file with coordinates for d1bkds_.
(The format of our PDB-style files is described here.)

Timeline for d1bkds_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bkdr_