Lineage for d1nf1a_ (1nf1 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006251Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2006252Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2006276Family a.116.1.2: p120GAP domain-like [48360] (2 protein domains)
  6. 2006277Protein GAP related domain of neurofibromin [48363] (1 species)
  7. 2006278Species Human (Homo sapiens) [TaxId:9606] [48364] (1 PDB entry)
  8. 2006279Domain d1nf1a_: 1nf1 A: [19110]

Details for d1nf1a_

PDB Entry: 1nf1 (more details), 2.5 Å

PDB Description: the gap related domain of neurofibromin
PDB Compounds: (A:) protein (neurofibromin)

SCOPe Domain Sequences for d1nf1a_:

Sequence, based on SEQRES records: (download)

>d1nf1a_ a.116.1.2 (A:) GAP related domain of neurofibromin {Human (Homo sapiens) [TaxId: 9606]}
erlvelvtmmgdqgelpiamalanvvpcsqwdelarvlvtlfdsrhllyqllwnmfskev
eladsmqtlfrgnslaskimtfcfkvygatylqklldpllrivitssdwqhvsfevdptr
lepsesleenqrnllqmtekffhaiissssefppqlrsvchclyqvvsqrfpqnsigavg
samflrfinpaivspyeagildkkpppiierglklmskilqsianhvlftkeehmrpfnd
fvksnfdaarrffldiasdcptsdavnhslsfisdgnvlalhrllwnnqekigqylssnr
dhkavgrrpfdkmatllaylgppe

Sequence, based on observed residues (ATOM records): (download)

>d1nf1a_ a.116.1.2 (A:) GAP related domain of neurofibromin {Human (Homo sapiens) [TaxId: 9606]}
erlvelvtmmgdqgelpiamalanvvpcsqwdelarvlvtlfdsrhllyqllwnmfskev
eladsmqtlfrgnslaskimtfcfkvygatylqklldplsleenqrnllqmtekffhaii
ssssefppqlrsvchclyqvvsqrfpqnsigavgsamflrfinpaivspyeapiierglk
lmskilqsianhvlftkeehmrpfndfvksnfdaarrffldiasalhrllwnnqekigqy
lssrpfdkmatllaylgppe

SCOPe Domain Coordinates for d1nf1a_:

Click to download the PDB-style file with coordinates for d1nf1a_.
(The format of our PDB-style files is described here.)

Timeline for d1nf1a_: