SCOP 1.57: Domain d1wq1g_: 1wq1 G:

Lineage for d1wq1g_ (1wq1 G:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)

4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (2 families)

5. Family a.116.1.2: p120GAP domain-like [48360] (2 proteins)

6. Protein p120GAP domain [48361] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48362] (2 PDB entries)

8. Domain d1wq1g_: 1wq1 G: [19109]
   Other proteins in same PDB: d1wq1r_

Details for d1wq1g_

PDB Entry: 1wq1, 2.5 Å

PDB Description: ras-rasgap complex

SCOP Domain Sequences for d1wq1g_:

Sequence; same for both SEQRES and ATOM records:

>d1wq1g_ a.116.1.2 (G:) p120GAP domain {Human (Homo sapiens)}
mpeeeysefkelilqkelhvvyalshvcgqdrtllasillriflhekleslllctlndre
ismedeattlfrattlastlmeqymkatatqfvhhalkdsilkimeskqscelspsklek
nedvntnlthllnilselvekifmaseilpptlryiygclqksvqhkwptnttmrtrvvs
gfvflrlicpailnprmfniisdspspiaartlilvaksvqnlanlvefgakepymegvn
pfiksnkhrmimfldelgnvpelpdttehsrtdlsrdlaalheicvahsdelrtlsnerg
aqqhvlkkllaitellqqkq

Timeline for d1wq1g_:

• d1wq1g_ first appeared (with stable ids) in SCOP 1.55
  
• d1wq1g_ appears in SCOP 1.59
  
• d1wq1g_ appears in the current release, SCOPe 2.08