Lineage for d1wera_ (1wer A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006251Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2006252Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2006276Family a.116.1.2: p120GAP domain-like [48360] (2 protein domains)
  6. 2006280Protein p120GAP domain [48361] (1 species)
  7. 2006281Species Human (Homo sapiens) [TaxId:9606] [48362] (2 PDB entries)
  8. 2006282Domain d1wera_: 1wer A: [19108]

Details for d1wera_

PDB Entry: 1wer (more details), 1.6 Å

PDB Description: ras-gtpase-activating domain of human p120gap
PDB Compounds: (A:) p120gap

SCOPe Domain Sequences for d1wera_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wera_ a.116.1.2 (A:) p120GAP domain {Human (Homo sapiens) [TaxId: 9606]}
mpeeeysefkelilqkelhvvyalshvcgqdrtllasillriflhekleslllctlndre
ismedeattlfrattlastlmeqymkatatqfvhhalkdsilkimeskqscelspsklek
nedvntnlthllnilselvekifmaseilpptlryiygclqksvqhkwptnttmrtrvvs
gfvflrlicpailnprmfniisdspspiaartlilvaksvqnlanlvefgakepymegvn
pfiksnkhrmimfldelgnvpelpdttehsrtdlsrdlaalheicvahsdelrtlsnerg
aqqhvlkkllaitellqqkqnqyt

SCOPe Domain Coordinates for d1wera_:

Click to download the PDB-style file with coordinates for d1wera_.
(The format of our PDB-style files is described here.)

Timeline for d1wera_: