Lineage for d1f7ca_ (1f7c A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006251Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2006252Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2006253Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 protein domains)
    Pfam PF00620
  6. 2006261Protein Graf [48358] (1 species)
    GTPase regulator associated with focal adhesion kinase
  7. 2006262Species Chicken (Gallus gallus) [TaxId:9031] [48359] (1 PDB entry)
  8. 2006263Domain d1f7ca_: 1f7c A: [19107]

Details for d1f7ca_

PDB Entry: 1f7c (more details), 2.4 Å

PDB Description: crystal structure of the bh domain from graf, the gtpase regulator associated with focal adhesion kinase
PDB Compounds: (A:) rhogap protein

SCOPe Domain Sequences for d1f7ca_:

Sequence, based on SEQRES records: (download)

>d1f7ca_ a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxId: 9031]}
aqldsigfsiikkcihavetrgineqglyrivgvnsrvqkllsilmdpktateteteica
eweiktitsalktylrmlpgplmmyqfqrsfikaaklenqesrvseihslvhrlpeknrq
mlhllmnhlakvadnhkqnlmtvanlgvvfgptllrpqeetvaaimdikfqnivieilie
nhekifntvpe

Sequence, based on observed residues (ATOM records): (download)

>d1f7ca_ a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxId: 9031]}
aqldsigfsiikkcihavetrgineqglyrivgvnsrvqkllsilmdpeteicaeweikt
itsalktylrmlpgplmmyqfqrsfikaaklenqesrvseihslvhrlpeknrqmlhllm
nhlakvadnhkqnlmtvanlgvvfgptllrptvaaimdikfqnivieilienhekifntv
pe

SCOPe Domain Coordinates for d1f7ca_:

Click to download the PDB-style file with coordinates for d1f7ca_.
(The format of our PDB-style files is described here.)

Timeline for d1f7ca_: