SCOP 1.75: Domain d2ngrb_: 2ngr B:

Lineage for d2ngrb_ (2ngr B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
   multihelical

4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (2 families)

5. Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (5 proteins)
   Pfam PF00620

6. Protein Cdc42GAP [48356] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48357] (2 PDB entries)

8. Domain d2ngrb_: 2ngr B: [19105]
   Other proteins in same PDB: d2ngra_
   complexed with gdp, mg; mutant

Details for d2ngrb_

PDB Entry: 2ngr, 1.9 Å

PDB Description: transition state complex for gtp hydrolysis by cdc42: comparisons of the high resolution structures for cdc42 bound to the active and catalytically compromised forms of the cdc42-gap.

PDB Compounds: (B:) protein (gtpase activating protein (rhg))

SCOP Domain Sequences for d2ngrb_:

Sequence; same for both SEQRES and ATOM records:

>d2ngrb_ a.116.1.1 (B:) Cdc42GAP {Human (Homo sapiens) [TaxId: 9606]}
lpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifarsantqvvrevqqk
ynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlqv
lqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainpi
ntftkflldhqgelfp

Timeline for d2ngrb_:

• d2ngrb_ first appeared (with stable ids) in SCOP 1.55
  
• d2ngrb_ appears in SCOP 1.73
  
• d2ngrb_ appears in SCOPe 2.01
  
• d2ngrb_ appears in the current release, SCOPe 2.08