![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
![]() | Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) ![]() |
![]() | Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins) Pfam PF00620 |
![]() | Protein Cdc42GAP [48356] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48357] (2 PDB entries) |
![]() | Domain d2ngrb_: 2ngr B: [19105] Other proteins in same PDB: d2ngra_ complexed with af3, gdp, mg |
PDB Entry: 2ngr (more details), 1.9 Å
SCOPe Domain Sequences for d2ngrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ngrb_ a.116.1.1 (B:) Cdc42GAP {Human (Homo sapiens) [TaxId: 9606]} lpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifarsantqvvrevqqk ynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlqv lqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainpi ntftkflldhqgelfp
Timeline for d2ngrb_: