Lineage for d2ngrb_ (2ngr B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725242Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2725243Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2725244Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins)
    Pfam PF00620
  6. 2725248Protein Cdc42GAP [48356] (1 species)
  7. 2725249Species Human (Homo sapiens) [TaxId:9606] [48357] (2 PDB entries)
  8. 2725251Domain d2ngrb_: 2ngr B: [19105]
    Other proteins in same PDB: d2ngra_
    complexed with af3, gdp, mg

Details for d2ngrb_

PDB Entry: 2ngr (more details), 1.9 Å

PDB Description: transition state complex for gtp hydrolysis by cdc42: comparisons of the high resolution structures for cdc42 bound to the active and catalytically compromised forms of the cdc42-gap.
PDB Compounds: (B:) protein (gtpase activating protein (rhg))

SCOPe Domain Sequences for d2ngrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ngrb_ a.116.1.1 (B:) Cdc42GAP {Human (Homo sapiens) [TaxId: 9606]}
lpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifarsantqvvrevqqk
ynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlqv
lqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainpi
ntftkflldhqgelfp

SCOPe Domain Coordinates for d2ngrb_:

Click to download the PDB-style file with coordinates for d2ngrb_.
(The format of our PDB-style files is described here.)

Timeline for d2ngrb_: