Lineage for d1pbwb_ (1pbw B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725242Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2725243Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2725244Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins)
    Pfam PF00620
  6. 2725263Protein p85 alpha subunit RhoGAP domain [48354] (1 species)
  7. 2725264Species Human (Homo sapiens) [TaxId:9606] [48355] (1 PDB entry)
  8. 2725266Domain d1pbwb_: 1pbw B: [19104]

Details for d1pbwb_

PDB Entry: 1pbw (more details), 2 Å

PDB Description: structure of bcr-homology (bh) domain
PDB Compounds: (B:) phosphatidylinositol 3-kinase

SCOPe Domain Sequences for d1pbwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbwb_ a.116.1.1 (B:) p85 alpha subunit RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]}
lpdlaeqfappdiapplliklveaiekkglecstlyrtqsssnlaelrqlldcdtpsvdl
emidvhvladafkrylldlpnpvipaavysemislapevqsseeyiqllkklirspsiph
qywltlqyllkhffklsqtssknllnarvlseifspmlfrfsaassdntenlikvieili
stewnerqpapalpp

SCOPe Domain Coordinates for d1pbwb_:

Click to download the PDB-style file with coordinates for d1pbwb_.
(The format of our PDB-style files is described here.)

Timeline for d1pbwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pbwa_