Lineage for d1pbwa_ (1pbw A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6011Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
  4. 6012Superfamily a.116.1: GTPase activation domain, GAP [48350] (2 families) (S)
  5. 6013Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (4 proteins)
  6. 6028Protein p85 alpha subunit RhoGAP domain [48354] (1 species)
  7. 6029Species Human (Homo sapiens) [TaxId:9606] [48355] (1 PDB entry)
  8. 6030Domain d1pbwa_: 1pbw A: [19103]

Details for d1pbwa_

PDB Entry: 1pbw (more details), 2 Å

PDB Description: structure of bcr-homology (bh) domain

SCOP Domain Sequences for d1pbwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbwa_ a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Human (Homo sapiens)}
lpdlaeqfappdiapplliklveaiekkglecstlyrtqsssnlaelrqlldcdtpsvdl
emidvhvladafkrylldlpnpvipaavysemislapevqsseeyiqllkklirspsiph
qywltlqyllkhffklsqtssknllnarvlseifspmlfrfsaassdntenlikvieili
stew

SCOP Domain Coordinates for d1pbwa_:

Click to download the PDB-style file with coordinates for d1pbwa_.
(The format of our PDB-style files is described here.)

Timeline for d1pbwa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pbwb_