Lineage for d1am4b_ (1am4 B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) Superfamily a.116.1: GTPase activation domain, GAP [48350] (2 families) 
Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (4 proteins) Protein p50 RhoGAP domain [48352] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48353] (3 PDB entries) 
Domain d1am4b_: 1am4 B: [19101]
Other proteins in same PDB: d1am4d_, d1am4e_, d1am4f_
Details for d1am4b_
PDB Entry: 1am4 (more details), 2.7 Å
PDB Description: complex between cdc42hs.gmppnp and p50 rhogap (h. sapiens)
SCOP Domain Sequences for d1am4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1am4b_ a.116.1.1 (B:) p50 RhoGAP domain {Human (Homo sapiens)}
prpplpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvre
vqqkynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpa
tlqvlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlka
inpintftkflldhqgelf
SCOP Domain Coordinates for d1am4b_:
Click to download the PDB-style file with coordinates for d1am4b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1am4b_:
- d1am4b_ appears in SCOP 1.57
- d1am4b_ appears in the current release, SCOPe 2.08
View in 3D
