Lineage for d1am4b_ (1am4 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725242Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2725243Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2725244Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins)
    Pfam PF00620
  6. 2725255Protein p50 RhoGAP domain [48352] (1 species)
  7. 2725256Species Human (Homo sapiens) [TaxId:9606] [48353] (4 PDB entries)
  8. 2725261Domain d1am4b_: 1am4 B: [19101]
    Other proteins in same PDB: d1am4d_, d1am4e_, d1am4f_
    complexed with gnp, mg

Details for d1am4b_

PDB Entry: 1am4 (more details), 2.7 Å

PDB Description: complex between cdc42hs.gmppnp and p50 rhogap (h. sapiens)
PDB Compounds: (B:) p50-rhogap

SCOPe Domain Sequences for d1am4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1am4b_ a.116.1.1 (B:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]}
prpplpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvre
vqqkynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpa
tlqvlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlka
inpintftkflldhqgelf

SCOPe Domain Coordinates for d1am4b_:

Click to download the PDB-style file with coordinates for d1am4b_.
(The format of our PDB-style files is described here.)

Timeline for d1am4b_: