Lineage for d1rgpa_ (1rgp A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006251Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2006252Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2006253Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 protein domains)
    Pfam PF00620
  6. 2006264Protein p50 RhoGAP domain [48352] (1 species)
  7. 2006265Species Human (Homo sapiens) [TaxId:9606] [48353] (4 PDB entries)
  8. 2006268Domain d1rgpa_: 1rgp A: [19099]

Details for d1rgpa_

PDB Entry: 1rgp (more details), 2 Å

PDB Description: gtpase-activation domain from rhogap
PDB Compounds: (A:) rhogap

SCOPe Domain Sequences for d1rgpa_:

Sequence, based on SEQRES records: (download)

>d1rgpa_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]}
prpplpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvre
vqqkynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpa
tlqvlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlka
inpintftkflldhqgelf

Sequence, based on observed residues (ATOM records): (download)

>d1rgpa_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]}
prpplpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvre
vqqkynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpa
tlqvlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwinpintftkf
lldhqgelf

SCOPe Domain Coordinates for d1rgpa_:

Click to download the PDB-style file with coordinates for d1rgpa_.
(The format of our PDB-style files is described here.)

Timeline for d1rgpa_: